Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 2
LigandBDBM503720
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
IC50 35.4±n/a nM
Citation Boehm, MCabral, SDowling, MSFutatsugi, KHuard, KLee, ECLondregan, ATPolivkova, JPrice, DALi, Q Diacylglycerol acyl transferase 2 inhibitors US Patent US11034678 Publication Date 6/15/2021
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 2
Name:Diacylglycerol O-acyltransferase 2
Synonyms:ARAT | Acyl-CoA retinol O-fatty-acyltransferase | DGAT2 | Diacylglycerol O-acyltransferase 2 (DGAT2) | Diglyceride acyltransferase 2 | Retinol O-fatty-acyltransferase
Type:Multi-pass membrane protein
Mol. Mass.:43848.90
Organism:Homo sapiens (Human)
Description:Q96PD7
Residue:388
Sequence:
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM503720
NameBDBM503720
Synonyms:US11034678, Example 3.6
TypeSmall organic molecule
Emp. Form.C22H25N5O5S
Mol. Mass.471.529
SMILESCCOc1cccnc1Oc1cncc(c1)-c1ncc(cn1)C(=O)NC(C)(C)CS(C)(=O)=O
Structure
n/a