Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFragile X mental retardation syndrome-related protein 1
LigandBDBM504310
Substrate/Competitorn/a
Meas. Tech.AlphaScreen Assay
EC50 42.0±2 nM
Citation Pellicciari, RGioiello, A Farnesoid X receptor modulators US Patent US11034717 Publication Date 6/15/2021
More Info.:Get all data from this article,  Assay Method
 
Fragile X mental retardation syndrome-related protein 1
Name:Fragile X mental retardation syndrome-related protein 1
Synonyms:hFXR1p
Type:Protein
Mol. Mass.:69715.95
Organism:Human
Description:P51114
Residue:621
Sequence:
MAELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPDIKKEIS
EGDEVEVYSRANDQEPCGWWLAKVRMMKGEFYVIEYAACDATYNEIVTFERLRPVNQNKT
VKKNTFFKCTVDVPEDLREACANENAHKDFKKAVGACRIFYHPETTQLMILSASEATVKR
VNILSDMHLRSIRTKLMLMSRNEEATKHLECTKQLAAAFHEEFVVREDLMGLAIGTHGSN
IQQARKVPGVTAIELDEDTGTFRIYGESADAVKKARGFLEFVEDFIQVPRNLVGKVIGKN
GKVIQEIVDKSGVVRVRIEGDNENKLPREDGMVPFVFVGTKESIGNVQVLLEYHIAYLKE
VEQLRMERLQIDEQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELS
DWSLAGEDDRDSRHQRDSRRRPGGRGRSVSGGRGRGGPRGGKSSISSVLKDPDSNPYSLL
DNTESDQTADTDASESHHSTNRRRRSRRRRTDEDAVLMDGMTESDTASVNENGLVTVADY
ISRAESQSRQRNLPRETLAKNKKEMAKDVIEEHGPSEKAINGPTSASGDDISKLQRTPGE
EKINTLKEENTQEAAVLNGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM504310
NameBDBM504310
Synonyms:3α,7α,11β-trihydroxy-6α-ethyl-22-(1,2,4-oxadiazol-5-oxo-3-yl)-23,24-bisnor-5β-cholane | US11034717, Compound 6
TypeSmall organic molecule
Emp. Form.C26H42N2O5
Mol. Mass.462.6221
SMILESCC[C@H]1[C@@H](O)C2C3CC[C@H]([C@H](C)Cc4nc(=O)o[nH]4)[C@@]3(C)C[C@H](O)C2[C@@]2(C)CC[C@@H](O)C[C@@H]12 |r|
Structure
n/a