Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNon-receptor tyrosine-protein kinase TYK2
LigandBDBM332970
Substrate/Competitorn/a
Meas. Tech.ATP Caliper Assay
IC50 119±n/a nM
Citation Greenwood, JRMasse, CELawson, JPArlin, JPearson, DLoughrey, JJ TYK2 inhibitors, uses, and methods for production thereof US Patent US11040967 Publication Date 6/22/2021
More Info.:Get all data from this article,  Assay Method
 
Non-receptor tyrosine-protein kinase TYK2
Name:Non-receptor tyrosine-protein kinase TYK2
Synonyms:Non-receptor tyrosine-protein kinase TYK2 (TYK2) | TYK2 | Tyrosine-protein kinase TYK2
Type:Protein
Mol. Mass.:133666.03
Organism:Homo sapiens (Human)
Description:P29597
Residue:1187
Sequence:
MPLRHWGMARGSKPVGDGAQPMAAMGGLKVLLHWAGPGGGEPWVTFSESSLTAEEVCIHI
AHKVGITPPCFNLFALFDAQAQVWLPPNHILEIPRDASLMLYFRIRFYFRNWHGMNPREP
AVYRCGPPGTEASSDQTAQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSTEEEIHHFK
NESLGMAFLHLCHLALRHGIPLEEVAKKTSFKDCIPRSFRRHIRQHSALTRLRLRNVFRR
FLRDFQPGRLSQQMVMVKYLATLERLAPRFGTERVPVCHLRLLAQAEGEPCYIRDSGVAP
TDPGPESAAGPPTHEVLVTGTGGIQWWPVEEEVNKEEGSSGSSGRNPQASLFGKKAKAHK
AVGQPADRPREPLWAYFCDFRDITHVVLKEHCVSIHRQDNKCLELSLPSRAAALSFVSLV
DGYFRLTADSSHYLCHEVAPPRLVMSIRDGIHGPLLEPFVQAKLRPEDGLYLIHWSTSHP
YRLILTVAQRSQAPDGMQSLRLRKFPIEQQDGAFVLEGWGRSFPSVRELGAALQGCLLRA
GDDCFSLRRCCLPQPGETSNLIIMRGARASPRTLNLSQLSFHRVDQKEITQLSHLGQGTR
TNVYEGRLRVEGSGDPEEGKMDDEDPLVPGRDRGQELRVVLKVLDPSHHDIALAFYETAS
LMSQVSHTHLAFVHGVCVRGPENIMVTEYVEHGPLDVWLRRERGHVPMAWKMVVAQQLAS
ALSYLENKNLVHGNVCGRNILLARLGLAEGTSPFIKLSDPGVGLGALSREERVERIPWLA
PECLPGGANSLSTAMDKWGFGATLLEICFDGEAPLQSRSPSEKEHFYQRQHRLPEPSCPQ
LATLTSQCLTYEPTQRPSFRTILRDLTRLQPHNLADVLTVNPDSPASDPTVFHKRYLKKI
RDLGEGHFGKVSLYCYDPTNDGTGEMVAVKALKADCGPQHRSGWKQEIDILRTLYHEHII
KYKGCCEDQGEKSLQLVMEYVPLGSLRDYLPRHSIGLAQLLLFAQQICEGMAYLHAQHYI
HRDLAARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKEYKFYY
ASDVWSFGVTLYELLTHCDSSQSPPTKFLELIGIAQGQMTVLRLTELLERGERLPRPDKC
PCEVYHLMKNCWETEASFRPTFENLIPILKTVHEKYQGQAPSVFSVC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM332970
NameBDBM332970
Synonyms:US10196390, Compound I-259 | US10336752, Compound 11 | US11040967, Compound 11
TypeSmall organic molecule
Emp. Form.C24H22F2N4O2
Mol. Mass.436.4539
SMILESCCN(CC)C(=O)c1ccc(Nc2cc(nc3CNC(=O)c23)-c2c(F)cccc2F)cc1
Structure
n/a