Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDiacylglycerol O-acyltransferase 2
LigandBDBM276752
Substrate/Competitorn/a
Meas. Tech.In Vitro Assay
IC50 13.0±n/a nM
Citation Edmonds, DJFilipski, KJFutatsugi, KGarnsey, MRLee, JCSmaltz, DJ Diacylglycerol acyl transferase 2 inhibitor US Patent US11065249 Publication Date 7/20/2021
More Info.:Get all data from this article,  Assay Method
 
Diacylglycerol O-acyltransferase 2
Name:Diacylglycerol O-acyltransferase 2
Synonyms:ARAT | Acyl-CoA retinol O-fatty-acyltransferase | DGAT2 | Diacylglycerol O-acyltransferase 2 (DGAT2) | Diglyceride acyltransferase 2 | Retinol O-fatty-acyltransferase
Type:Multi-pass membrane protein
Mol. Mass.:43848.90
Organism:Homo sapiens (Human)
Description:Q96PD7
Residue:388
Sequence:
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM276752
NameBDBM276752
Synonyms:2-(5-((3-ethoxypyridin- 2-yl)oxy)pyridin-3-yl)-N-(3- methyl-1,1-dioxidotetra- hydrothiophen-3-yl) pyrimidine-5-carboxamide | US10071992, Example 3.1 | US11034678, Example 3.1 | US11065249, WO2018033832-Ex.-3.1
TypeSmall organic molecule
Emp. Form.C22H23N5O5S
Mol. Mass.469.514
SMILESCCOc1cccnc1Oc1cncc(c1)-c1ncc(cn1)C(=O)NC1(C)CCS(=O)(=O)C1
Structure
n/a