Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSRSF protein kinase 1
LigandBDBM50500353
Substrate/Competitorn/a
Meas. Tech.Inhibition Assay
IC50 5.09±n/a nM
Citation Hatcher, JGray, NSChoi, HJanne, PZhang, T Substituted 6,11-dihydro-5H-benzo[B]carbazoles as inhibitors of ALK and SRPK US Patent US11066363 Publication Date 7/20/2021
More Info.:Get all data from this article,  Assay Method
 
SRSF protein kinase 1
Name:SRSF protein kinase 1
Synonyms:SRPK1 | SRSF protein kinase 1 (SRPK1) | Serine/arginine-protein kinase 1 (SRPK1) | Serine/threonine-protein kinase SRPK1
Type:Protein
Mol. Mass.:74318.38
Organism:Homo sapiens (Human)
Description:Q96SB4
Residue:655
Sequence:
MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPN
DYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTET
ALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSN
YQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILLSVNEQYIRRLAAEATEWQR
SGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAELLEKRMQEIEEMEKESGPGQ
KRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGGAAEINCNGVI
EVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLV
NPLEPKNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACM
AFELATGDYLFEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHI
TKLKPWGLFEVLVEKYEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWLNS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50500353
NameBDBM50500353
Synonyms:CHEMBL3746395 | US11066363, Compound 10
TypeSmall organic molecule
Emp. Form.C24H19N3O2
Mol. Mass.381.4266
SMILESCCc1cc2C(=O)c3c([nH]c4cc(ccc34)C#N)C(C)(C)c2cc1-c1cnoc1
Structure
n/a