TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 0.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
Affinity DataKi: 0.990nMAssay Description:Binding affinity to NR1/NR2B receptorMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 1nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Binding affinity to NR1/NR2B receptorMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 1.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 1.5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetD(2) dopamine receptor(Homo sapiens (Human))
Case Western Reserve University
Curated by PDSP Ki Database
Case Western Reserve University
Curated by PDSP Ki Database
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of CDK2/Cyclin A (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetD(3) dopamine receptor(Rattus norvegicus (Rat))
Case Western Reserve University
Curated by PDSP Ki Database
Case Western Reserve University
Curated by PDSP Ki Database
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 4nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of CDK9/Cyclin T1 (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK2/Cyclin A expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of CDK2/Cyclin A (unknown origin) by radiometric assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK1/Cyclin B expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 6nMAssay Description:Inhibition of human recombinant His6 tagged CDK9/CyclinT1 expressed in Sf21 insect cells after 40 mins by scintillation counting analysisMore data for this Ligand-Target Pair