Report error Found 551 with Last Name = 'dai' and Initial = 'w'
Affinity DataIC50: 0.220nMAssay Description:Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ...More data for this Ligand-Target Pair
Affinity DataIC50: <0.300nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 0.320nMAssay Description:Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ...More data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 0.400nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 0.5nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 0.600nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 0.700nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 0.800nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 0.900nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 0.900nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.0 T: 25°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMpH: 7.0 T: 25°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC, 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of human Protein kinase C alphaMore data for this Ligand-Target Pair
Affinity DataIC50: 4nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
