Compile Data Set for Download or QSAR
maximum 50k data
Report error Found 551 with Last Name = 'dai' and Initial = 'w'
TargetGlutathione S-transferase omega-1(Human)
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50526135(CHEMBL4593975)
Affinity DataIC50:  0.220nMAssay Description:Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387172(3-(5-((5-chloro-2-((1-(6-methoxypyridin-3-yl)-1H-p...)
Affinity DataIC50: <0.300nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetGlutathione S-transferase omega-1(Human)
Sichuan University

Curated by ChEMBL
LigandPNGBDBM50526136(CHEMBL4513682)
Affinity DataIC50:  0.320nMAssay Description:Inhibition of CMFDA binding to human N-terminal 6x-His-tagged GSTO1-1 preincubated for 30 mins followed by CMFDA addition and measured after 30 mins ...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239977(US9403801, 48)
Affinity DataIC50:  0.400nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239968(US9403801, 33)
Affinity DataIC50:  0.400nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239976(US9403801, 46)
Affinity DataIC50:  0.5nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387194(5-((5-chloro-2-((1-(2-hydroxypropyl)-1H-pyrazol-4-...)
Affinity DataIC50:  0.600nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387171(3-(5-((5-chloro-2-((1-(pyridin-2-yl)-1H-pyrazol-4-...)
Affinity DataIC50:  0.600nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387182(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  0.700nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387192(5-((5-chloro-2-((1-(2-hydroxypropyl)-1H-pyrazol-4-...)
Affinity DataIC50:  0.800nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387184(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  0.800nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  0.800nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase A(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387186(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  0.800nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239965(US9403801, 30)
Affinity DataIC50:  0.900nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239963(US9403801, 28)
Affinity DataIC50:  0.900nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239953(US9403801, 12)
Affinity DataIC50:  1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase A(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387184(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  1nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387186(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  1nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387181(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387186(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetNon-receptor tyrosine-protein kinase TYK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  1nMpH: 7.0 T: 25°CAssay Description:TYK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 250 μM GGMEDIYFEFMGGKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity approx...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387191(1-(4-((5-chloro-4-((2-(cyclopropylsulfonyl)octahyd...)
Affinity DataIC50:  1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387193(1-(4-((5-chloro-4-((2-((cyclopropylmethyl)sulfonyl...)
Affinity DataIC50:  1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239966(US9403801, 31)
Affinity DataIC50:  1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239981(US9403801, 59)
Affinity DataIC50:  1nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387187(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  1nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239954(US9403801, 13.3A | US9403801, 13.3B)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239985(US9403801, 64)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239955(US9403801, 14A | US9403801, 14B)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239958(US9403801, 22)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239961(US9403801, 26)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239964(US9403801, 29)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387170(3-(5-((5-chloro-2-((1-(2-hydroxy-2-methylpropyl)-1...)
Affinity DataIC50:  2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387182(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387185(1-(4-((5-chloro-4-((3-(methylsulfonyl)-3-azaspiro[...)
Affinity DataIC50:  2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387187(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  2nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase A(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387187(1-(4-((5-chloro-4-((2-(methyl sulfonyl)octahydrocy...)
Affinity DataIC50:  2nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387177(US9938257, Example 15 | ethyl 5-((5-chloro-2-((1-m...)
Affinity DataIC50:  2nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase B(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387180(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  2nMAssay Description:Aurora-B:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239969(US9403801, 34)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239970(US9403801, 35)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239954(US9403801, 13.3A | US9403801, 13.3B)
Affinity DataIC50:  2nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239957(US9403801, 20)
Affinity DataIC50:  3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetAurora kinase A(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387182(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  3nMAssay Description:Aurora-A:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding w...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK2(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239968(US9403801, 33)
Affinity DataIC50:  3nMpH: 7.0 T: 25°CAssay Description:JAK2 (h) is incubated with 8 mM MOPS pH 7.0, 0.2 mM EDTA, 100 μM [protein fragment, 39 aa], 10 mM MgAcetate and [γ-33P-ATP](s...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239967(US9403801, 32)
Affinity DataIC50:  3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239974(US9403801, 42)
Affinity DataIC50:  3nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM387184(5-((5-chloro-2-((1-methyl-1H-pyrazol-4-yl)amino)py...)
Affinity DataIC50:  3nMAssay Description:JAK1:Kinase assays can be performed by measurement of incorporation of γ-33P ATP into immobilized myelin basic protein (MBP). High binding white...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


TargetGlycogen synthase kinase-3 beta(Human)
Wuhan Institute of Technology

Curated by ChEMBL
LigandPNGBDBM50147472(3-[1-(3-Hydroxy-propyl)-1H-pyrrolo[2,3-b]pyridin-3...)
Affinity DataIC50:  4nMAssay Description:Inhibition of human Protein kinase C alphaMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed

TargetTyrosine-protein kinase JAK1(Human)
Calitor Sciences

US Patent
LigandPNGBDBM239962(US9403801, 27)
Affinity DataIC50:  4nMpH: 7.5 T: 25°CAssay Description:JAK1 (h) is incubated with 20 mM Tris/HCl pH 7.5, 0.2 mM EDTA, 500 μM GEEPLYWSFPAKKK, 10 mM MgAcetate and [γ-33P-ATP](specific activity app...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails US Patent


Displayed 1 to 50 (of 551 total ) | Next | Last >>
Jump to: