Compile Data Set for Download or QSAR
maximum 50k data
Found 93 of ic50 data for polymerid = 50006377
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM126500(US11591322, Compound NVP-2 | US8778951, 310)
Affinity DataIC50:  2nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466226(CHEMBL4293213)
Affinity DataIC50:  2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466217(CHEMBL4287416)
Affinity DataIC50:  2nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50363196(CHEMBL1944698)
Affinity DataIC50:  3nMAssay Description:Inhibition of human recombinant full length His-tagged CDK9/cyclin K expressed in baculovirus expression systemMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466210(CHEMBL4281048)
Affinity DataIC50:  6nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466216(CHEMBL4291684)
Affinity DataIC50:  9nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466238(CHEMBL4277623)
Affinity DataIC50:  10nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466240(CHEMBL4286005)
Affinity DataIC50:  12nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50433369(CHEMBL2377825)
Affinity DataIC50:  13nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin)-mediated phosphorylation of peptide substrate incubated for 15 mins prior to substrate addition measured...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466218(CHEMBL4278245)
Affinity DataIC50:  14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466222(CHEMBL4279576)
Affinity DataIC50:  14nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466221(CHEMBL4281710)
Affinity DataIC50:  17nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466235(CHEMBL4282838)
Affinity DataIC50:  22nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466219(CHEMBL4293383)
Affinity DataIC50:  27nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466212(CHEMBL4287488)
Affinity DataIC50:  28nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50270298(CHEMBL4075720)
Affinity DataIC50:  39nMAssay Description:Inhibition of human CDK9/Cyclin K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate preincubated for 20 mins followed by [gamma-33P]-ATP add...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538150(CHEMBL4647703)
Affinity DataIC50:  40nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538119(CHEMBL4633552)
Affinity DataIC50:  51nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466225(CHEMBL4278079)
Affinity DataIC50:  51nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50110183(Abemaciclib | LY-2835219 | US10626107, Example LY2...)
Affinity DataIC50:  65nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466233(CHEMBL4285545)
Affinity DataIC50:  80nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466213(CHEMBL4290724)
Affinity DataIC50:  84nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466239(CHEMBL4276761)
Affinity DataIC50:  90nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466232(CHEMBL4288923)
Affinity DataIC50:  94nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466220(CHEMBL4277182)
Affinity DataIC50:  96nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466229(CHEMBL4279380)
Affinity DataIC50:  101nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466211(CHEMBL4292333)
Affinity DataIC50:  101nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466234(CHEMBL4285140)
Affinity DataIC50:  107nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466214(CHEMBL4279156)
Affinity DataIC50:  114nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538118(CHEMBL4639504)
Affinity DataIC50:  114nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  137nMAssay Description:Inhibition of human CDK9/cyclin-K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466228(CHEMBL4287306)
Affinity DataIC50:  150nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538116(CHEMBL4641351)
Affinity DataIC50:  152nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538123(CHEMBL4635295)
Affinity DataIC50:  176nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM2579((2S,3R,4R,6R)-3-methoxy-2-methyl-4-(methylamino)-2...)
Affinity DataIC50:  214nMAssay Description:Inhibition of human CDK9/cyclin-K using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50564790(CHEMBL4781627)
Affinity DataIC50:  235nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) preincubated for 20 mins followed by ATP addition and measured after 120 mins in presence of [33P-gamma]...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466230(CHEMBL4286229)
Affinity DataIC50:  238nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466242(CHEMBL4289836)
Affinity DataIC50:  253nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538141(CHEMBL4638056)
Affinity DataIC50:  431nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538121(CHEMBL4635619)
Affinity DataIC50:  434nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466241(CHEMBL4289648)
Affinity DataIC50:  557nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538144(CHEMBL4647649)
Affinity DataIC50:  654nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466223(CHEMBL4286410)
Affinity DataIC50:  733nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538122(CHEMBL4639071)
Affinity DataIC50:  751nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538126(CHEMBL4644673)
Affinity DataIC50:  880nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538112(CHEMBL4640779)
Affinity DataIC50:  908nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50466231(CHEMBL4278973)
Affinity DataIC50:  1.04E+3nMAssay Description:Inhibition of CDK9/Cyclin K (unknown origin) using PDKtide as substrate incubated at 37 degreeC for 1 hr followed by incubation at room temperature f...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538124(CHEMBL4639374)
Affinity DataIC50:  1.12E+3nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM6309(6-Acetyl-8-cyclopentyl-5-methyl-2-(5-piperazin-1-y...)
Affinity DataIC50:  1.21E+3nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-K(Homo sapiens (Human))
Anhui Medical University

Curated by ChEMBL
LigandPNGBDBM50538148(CHEMBL4645060)
Affinity DataIC50:  1.38E+3nMAssay Description:Inhibition of recombinant human full-length N-terminal GST-tagged CDK9/cyclinK expressed in baculovirus infected Sf9 insect cells using PDKtide as su...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 93 total ) | Next | Last >>
Jump to: