Cell Reactant:
CAM-RNase A
Syringe Reactant:
SecB
Meas. Tech.:
ITC
Entry Date.:
12/13/00
ΔG°:
-6.63±n/a (kcal/mole)
pH:
7.4±n/a
Temperature:
293.15±n/a (K)
ΔH° :
-11.86±n/a (kJ/mole)
ΔCp :
-0.41±n/a (kJ/mole)
Stoich. Param.:
1
ΔS° :
-0.02±n/a (kJ/mole-K)
Comments:
discrepancies in the fluorescence and calorimetric-derived binding constants
Citation
 Panse, VGSwaminathan, CPSurolia, AVaradarajan, R Thermodynamics of substrate binding to the chaperone SecB. Biochemistry 39:2420-7 (2000) [PubMed]  Article
Cell React
Name:
Ribonuclease pancreatic
Synonyms:
CAM-RNase A | RNAse A
Type:
Enzyme
Mol. Mass.:
16468.79
Organism:
Bison bison (American bison)
Description:
carboxamidomethylated RNase A
Residue:
150
Sequence:
MALKSLVLLSLLVLVLLLVRVQPSLGKETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
  
Syringe React
Source:
Expressed in E. coli strain BL21 (DE3)
Purity:
99%
Prep. Method:
Fast flow Q-Sepharose column, and then a Sephacryl S-200 gel filtration column
Name:
SecB
Synonyms:
n/a
Type:
Protein
Mol. Mass.:
17264.58
Organism:
Escherichia coli
Description:
D6JGS5
Residue:
155
Sequence:
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA