Cell Reactant:
CAM-alpha-lactalbumin
Syringe Reactant:
SecB
Meas. Tech.:
ITC
Entry Date.:
12/13/00
ΔG°:
-27.72±n/a (kJ/mole)
pH:
7.4±n/a
Temperature:
293.15±n/a (K)
ΔH° :
-22.68±n/a (kJ/mole)
Stoich. Param.:
1
ΔS° :
0.0168±n/a (kJ/mole-K)
Comments:
discrepancies in the fluorescence and calorimetric-derived binding constants
Citation
 Panse, VGSwaminathan, CPSurolia, AVaradarajan, R Thermodynamics of substrate binding to the chaperone SecB. Biochemistry 39:2420-7 (2000) [PubMed]  Article
Cell React
Prep. Method:
Reduction with DTT and subsequent titration with DTNB, confirmed the number of disulfides present.
Name:
CAM-alpha-lactalbumin
Synonyms:
2S-ScamLA | 3S-ScamLA
Type:
Protein
Mol. Mass.:
16219.69
Organism:
Homo sapiens (Human)
Description:
P00709
Residue:
142
Sequence:
MRFFVPLFLVGILFPAILAKQFTKCELSQLLKDIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLFQISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAKKILDIKGIDYWLAHKALCTEKLEQWLCEKL
  
Syringe React
Source:
Expressed in E. coli strain BL21 (DE3)
Purity:
99%
Prep. Method:
Fast flow Q-Sepharose column, and then a Sephacryl S-200 gel filtration column
Name:
SecB
Synonyms:
n/a
Type:
Protein
Mol. Mass.:
17264.58
Organism:
Escherichia coli
Description:
D6JGS5
Residue:
155
Sequence:
MSEQNNTEMTFQIQRIYTKDISFEAPNAPHVFQKDWQPEVKLDLDTASSQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIAGIEGTQMAHCLGAYCPNILFPYARECITSMVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGTEEHQDA