Cell Reactant:
HyHEL-5 Fab
Syringe Reactant:
Lysozyme (hen egg)
Meas. Tech.:
ITC and sedimentation equilibrium
Entry Date.:
12/13/00
ΔG°:
-60.9±n/a (kJ/mole)
pH:
8±n/a
Temperature:
298.15±n/a (K)
ΔH° :
-95.76±0.84 (kJ/mole)
ΔHobs :
-95.76±n/a (kJ/mole)
Corrected for ΔHioniz:
not known
ΔCp :
-1.722±0.076 (kJ/mole)
ΔS° :
-0.117±n/a (kJ/mole-K)
Comments:
data from Lavoie, T. B., Drohan, W. N., and Smith-Gill, S. J. (1992) J. Immunol. 148, 503-513
Citation
 Wibbenmeyer, JASchuck, PSmith-Gill, SJWillson, RC Salt links dominate affinity of antibody HyHEL-5 for lysozyme through enthalpic contributions. J Biol Chem 274:26838-42 (1999) [PubMed]  Article
Cell React
Source:
Recombinant HyHEL-5 Fab was expressed in E. coli.
Purity:
95%
Prep. Method:
Refolded protein was purified by Q Sepharose and nickel-charged chelating Sepharose Fast Flow Chromatography
Name:
HyHEL-5 Fab
Synonyms:
n/a
Type:
Antibody
Mol. Mass.:
23011.84
Organism:
Mus musculus (mouse)
Description:
Monoclonal antibody to hen egg lysozyme
Residue:
215
Sequence:
EVQLQQSGAELMKPGASVKISCKASGYTFSDYWIEWVKQRPGHGLEWIGEILPGSGSTNYHERFKGKATFTADTSSSTAYMQLNSLTSEDSGVYYCLHGNYDFDGWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKILD
  
Syringe React
Source:
Worthington Biologicals
Name:
Lysozyme C
Synonyms:
FvD1.3(VLW92A) | FvD1.3(VLW92D) | FvD1.3(VLW92F) | FvD1.3(VLW92H) | FvD1.3(VLW92S) | FvD1.3(VLW92V) | FvD1.3(VLW92wt) | Lysozyme (hen egg) | hen egg lysozyme (HEL)
Type:
Enzyme
Mol. Mass.:
16248.07
Organism:
Gallus gallus (chicken)
Description:
P00698
Residue:
147
Sequence:
MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL