Cell Reactant:
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Syringe Reactant:
Puma Mutant (M144I)
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
09/13/09
pH:
7.4±n/a
Temperature:
298.15±n/a (K)
ΔH° :
-14.3±n/a (kJ/mole)
Corrected for ΔHioniz:
yes
ΔS° :
-0.01±n/a (kJ/mole-K)
Citation
 Day, CLSmits, CFan, FCLee, EFFairlie, WDHinds, MG Structure of the BH3 domains from the p53-inducible BH3-only proteins Noxa and Puma in complex with Mcl-1. J Mol Biol 380:958-71 (2008) [PubMed]  Article
Cell React
Source:
The protein was expressed in E. coli as a GST-fusion.
Name:
Induced myeloid leukemia cell differentiation protein Mcl-1 homolog
Synonyms:
Bcl-2-related protein EAT/mcl1 | Mcl-1
Type:
Developmental protein
Mol. Mass.:
35215.08
Organism:
Mus musculus (Mouse)
Description:
n/a
Residue:
331
Sequence:
MFGLRRNAVIGLNLYCGGASLGAGGGSPAGARLVAEEAKARREGGGEAALLPGARVVARPPPVGAEDPDVTASAERRLHKSPGLLAVPPEEMAASAAAAIVSPEEELDGCEPEAIGKRPAVLPLLERVSEAAKSSGADGSLPSTPPPPEEEEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHETAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQESFIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGGIRNVLLAFAGVAGVGAGLAYLIR
  
Syringe React
Name:
Puma Mutant (M144I)
Synonyms:
n/a
Type:
BH3 domain peptide
Mol. Mass.:
3186.41
Organism:
Mus musculus (Mouse)
Description:
n/a
Residue:
26
Sequence:
EEEWAREIGAQLRRIADDLNAQYERR