Cell Reactant:
HIV-1 Protease Mutant, A-1
Syringe Reactant:
BDBM520
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
06/23/04
ΔG°:
-50.16±n/a (kJ/mole)
pH:
5±n/a
Log10Kb:
7.5
Temperature:
298.15±n/a (K)
ΔH° :
0.0836±n/a (kJ/mole)
ΔHobs :
0.0836±n/a (kJ/mole)
Corrected for ΔHioniz:
not known
ΔS° :
0.1686±n/a (kJ/mole-K)
Comments:
In displacement titration experiments, inhibitors were injected into the calorimetric cell containing the protein prebound to a weak inhibitor, acetylpepstatin
Citation
 Muzammil, SMuzammil, SRoss, PRoss, PFreire, EFreire, E A major role for a set of non-active site mutations in the development of HIV-1 protease drug resistance. Biochemistry 42:631-8 (2003) [PubMed]  Article
Cell React
Source:
Plasmid-encoded HIV-1 protease was expressed in E. coli cells.
Purity:
99%
Prep. Method:
HIV-1 protease was purified and refolded from E. coli inclusion bodies.
Name:
Dimer of Gag-Pol polyprotein [489-587,Q496K,I573V]
Synonyms:
HIV-1 Protease Mutant, A-1
Type:
Protein Complex
Mol. Mass.:
n/a
Description:
n/a
Components:
This complex has 2 components.
Component 1
Name:
Gag-Pol polyprotein [489-587,Q496K,I573V]
Synonyms:
HIV-1 Protease Mutant(Q7K/I84V) | HIV-1 Protease Mutant, A-1 chain A | HIV-1 Protease Mutant, A-1 chain B
Type:
Enzyme Subunit
Mol. Mass.:
10768.18
Organism:
Human immunodeficiency virus type 1
Description:
All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:
99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
  
Component 2
Name:
Gag-Pol polyprotein [489-587,Q496K,I573V]
Synonyms:
HIV-1 Protease Mutant(Q7K/I84V) | HIV-1 Protease Mutant, A-1 chain A | HIV-1 Protease Mutant, A-1 chain B
Type:
Enzyme Subunit
Mol. Mass.:
10768.18
Organism:
Human immunodeficiency virus type 1
Description:
All of the protease constructs in this study are on the wild type containing the single Q7K mutation to prevent autocatalysis.This protein has enzymatic properties similar to that of the wild type protease.
Residue:
99
Sequence:
PQVTLWKRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNVIGRNLLTQIGCTLNF
  
Syringe React
Source:
Purified from commercial capsules
Prep. Method:
Further purified by HPLC using a semipreparative C-18 reversed-phase column developed with 0-100% acetonitrile in 0.05% TFA
Name:
BDBM520
Synonyms:
1,3-thiazol-5-ylmethyl N-[(2S,3S,5S)-3-hydroxy-5-[(2S)-3-methyl-2-{[methyl({[2-(propan-2-yl)-1,3-thiazol-4-yl]methyl})carbamoyl]amino}butanamido]-1,6-diphenylhexan-2-yl]carbamate | ABT-538 | CHEMBL163 | Norvir | RTV | Ritonavir
Type:
Small organic molecule
Emp. Form.:
n/a
Mol. Mass.:
n/a
SMILES:
n/a
Structure:
Search PDB for entries with ligand similarity: