Target
Activin receptor type-1 [147-509]
Ligand
BDBM518212
Substrate
n/a
Meas. Tech.
HTRF Assay (3 uM ATP)
IC50
1250±n/a nM
Citation
 Vechorkin, ONguyen, MQi, CWang, AWu, LYao, WZhao, P Pyrazolopyrimidine compounds and uses thereof US Patent  US11111247 Publication Date 9/7/2021 
Target
Name:
Activin receptor type-1 [147-509]
Synonyms:
ACVR1 | ACVR1_HUMAN | ACVRLK2 | Activin receptor-like kinase 2 (ALK-2) (aa 147-509)
Type:
Enzyme Catalytic Domain
Mol. Mass.:
41331.39
Organism:
Homo sapiens (Human)
Description:
aa147-end
Residue:
363
Sequence:
RKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
  
Inhibitor
Name:
BDBM518212
Synonyms:
US11111247, Example 49
Type:
Small organic molecule
Emp. Form.:
C16H18N8O
Mol. Mass.:
338.3671
SMILES:
CN1CC2CCC(N2c2ncc3[nH]nc(-c4cnn(C)c4)c3n2)C1=O
Structure:
Search PDB for entries with ligand similarity: