Target
Eukaryotic translation initiation factor 4E-binding protein 1
Ligand
BDBM545304
Substrate
n/a
Meas. Tech.
Fluorescence Polarization Assay
IC50
3.59±n/a nM
Citation
 Sperry, SXiang, AXErnst, JTReich, SHSprengeler, PAShaghafi, MMichels, TNilewski, CTran, CVPackard, GKGrubbs, AUrkalan, KMukaiyama, T EIF4E-inhibiting compounds and methods US Patent  US11286268 Publication Date 3/29/2022
Target
Name:
Eukaryotic translation initiation factor 4E-binding protein 1
Synonyms:
GFP-4EBP | GFP-4EBP1 | Green fluorescent protein-Eukaryotic initiation factor 4E (eIF4E) binding protein
Type:
Fusion protein
Mol. Mass.:
12578.35
Organism:
Homo sapiens (Human)
Description:
n/a
Residue:
118
Sequence:
MSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI
  
Inhibitor
Name:
BDBM545304
Synonyms:
US11286268, Compound 791
Type:
Small organic molecule
Emp. Form.:
C28H23ClN6O4S
Mol. Mass.:
575.038
SMILES:
CN(C)c1ncc2nc(C)n(CCOc3ccc(Cl)cc3-c3cc(C)nc4c(csc34)C(O)=O)c(=O)c2c1C#N
Structure:
Search PDB for entries with ligand similarity: