Target
Mitogen-activated protein kinase 14
Ligand
BDBM14838
Substrate
BDBM14832
Meas. Tech.
Fluorescence Exchange Curve Assay
pH
7±n/a
Temperature
296.15±n/a K
Kd
6±n/a nM
Citation
 Kroe, RRRegan, JProto, APeet, GWRoy, TLandro, LDFuschetto, NGPargellis, CAIngraham, RH Thermal denaturation: a method to rank slow binding, high-affinity P38alpha MAP kinase inhibitors. J Med Chem 46:4669-75 (2003) [PubMed]  Article
Target
Name:
Mitogen-activated protein kinase 14
Synonyms:
CRK1 | MAP Kinase p38 alpha | MAP kinase p38 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha
Type:
Enzyme
Mol. Mass.:
41281.22
Organism:
Mus musculus (mouse)
Description:
The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography.
Residue:
360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
  
Inhibitor
Name:
BDBM14838
Synonyms:
1-(5-iso-Propyl-2-phenyl-2H-pyrazol-3-yl)-3-[4-(2-morpholin-4-yl-ethoxy)-naphthalen-1-yl]-urea | 1-{4-[2-(morpholin-4-yl)ethoxy]naphthalen-1-yl}-3-[1-phenyl-3-(propan-2-yl)-1H-pyrazol-5-yl]urea | BIRB-796 Analog 32 | CHEMBL105248 | diaryl urea compound 7
Type:
Small organic molecule
Emp. Form.:
C29H33N5O3
Mol. Mass.:
499.604
SMILES:
CC(C)c1cc(NC(=O)Nc2ccc(OCCN3CCOCC3)c3ccccc23)n(n1)-c1ccccc1
Structure:
Search PDB for entries with ligand similarity:
Substrate
Name:
BDBM14832
Synonyms:
3-(4-fluorophenyl)-2-pyridin-4-yl-6-thia-1,4-diazabicyclo[3.3.0]octa-2,4-diene | 4-[6-(4-fluorophenyl)-2H,3H-imidazo[2,1-b][1,3]thiazol-5-yl]pyridine | CHEMBL313417 | SKF 86002
Type:
Small organic molecule
Emp. Form.:
C16H12FN3S
Mol. Mass.:
297.35
SMILES:
Fc1ccc(cc1)-c1nc2SCCn2c1-c1ccncc1
Structure:
Search PDB for entries with ligand similarity: