Target
Tyrosine-protein phosphatase non-receptor type 7
Ligand
BDBM46188
Substrate
n/a
Meas. Tech.
MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds
IC50
816±n/a nM
Citation
 PubChem, PC MOA HePTP Fluorescent secondary assay for identification of redox-state modulating compounds PubChem Bioassay (2009)[AID] 
Target
Name:
Tyrosine-protein phosphatase non-receptor type 7
Synonyms:
He-PTP | Hematopoietic protein-tyrosine phosphatase | Hematopoietic protein-tyrosine phosphatase (HEPTP) | PTN7_HUMAN | PTPN7 | Protein-tyrosine phosphatase LC-PTP | Tyrosine-protein phosphatase non-receptor type 7 | Tyrosine-protein phosphatase non-receptor type 7 (HEPTP)
Type:
Protein
Mol. Mass.:
40530.79
Organism:
Homo sapiens (Human)
Description:
P35236
Residue:
360
Sequence:
MVQAHGGRSRAQPLTLSLGAAMTQPPPEKTPAKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEPSP
  
Inhibitor
Name:
BDBM46188
Synonyms:
1-[2,3-bis(2-furanyl)-6-quinoxalinyl]-3-methylurea | 1-[2,3-bis(2-furyl)quinoxalin-6-yl]-3-methyl-urea | 1-[2,3-bis(furan-2-yl)quinoxalin-6-yl]-3-methyl-urea | 1-[2,3-bis(furan-2-yl)quinoxalin-6-yl]-3-methylurea | MLS-0202054.0001 | cid_1092683
Type:
Small organic molecule
Emp. Form.:
C18H14N4O3
Mol. Mass.:
334.3288
SMILES:
CNC(=O)Nc1ccc2nc(-c3ccco3)c(nc2c1)-c1ccco1
Structure:
Search PDB for entries with ligand similarity: