Target
Cysteinyl leukotriene receptor 1
Ligand
BDBM50015539
Substrate
n/a
Meas. Tech.
ChEMBL_52225
Ki
58±n/a nM
Citation
 Matassa, VGMaduskuie, TPShapiro, HSHesp, BSnyder, DWAharony, DKrell, RDKeith, RA Evolution of a series of peptidoleukotriene antagonists: synthesis and structure/activity relationships of 1,3,5-substituted indoles and indazoles. J Med Chem 33:1781-90 (1990) [PubMed]  Article  BDB Entry
Target
Name:
Cysteinyl leukotriene receptor 1
Synonyms:
n/a
Type:
Enzyme Catalytic Domain
Mol. Mass.:
39007.58
Organism:
GUINEA PIG
Description:
Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:
340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
  
Inhibitor
Name:
BDBM50015539
Synonyms:
4-(5-Cyclopentyloxycarbonylamino-1-propyl-1H-indol-3-ylmethyl)-3-methoxy-benzoic acid | CHEMBL422404
Type:
Small organic molecule
Emp. Form.:
C26H30N2O5
Mol. Mass.:
450.5268
SMILES:
CCCn1cc(Cc2ccc(cc2OC)C(O)=O)c2cc(NC(=O)OC3CCCC3)ccc12
Structure:
Search PDB for entries with ligand similarity: