Target
Nonstructural protein 3
Ligand
BDBM50528562
Substrate
n/a
Meas. Tech.
ChEMBL_1905425 (CHEMBL4407783)
IC50
8100±n/a nM
Citation
 Rassias, GZogali, VSwarbrick, CMDKi Chan, KWChan, SAGwee, CPWang, SKaplanai, ECanko, AKiousis, DLescar, JLuo, DMatsoukas, MTVasudevan, SG Cell-active carbazole derivatives as inhibitors of the zika virus protease. Eur J Med Chem 180:536-545 (2019) [PubMed]  Article 
Target
Name:
Nonstructural protein 3
Synonyms:
Genome polyprotein | NS3
Type:
PROTEIN
Mol. Mass.:
7653.58
Organism:
Zika virus
Description:
ChEMBL_119671
Residue:
66
Sequence:
AETDEDHAHWLEARMLLDNIYLQDGLIASLYRPEADKVAAIEGEFKLRTEQRKTFVELMKRGDLPV
  
Inhibitor
Name:
BDBM50528562
Synonyms:
CHEMBL4548788
Type:
Small organic molecule
Emp. Form.:
C26H20BrN3O3S
Mol. Mass.:
534.424
SMILES:
COc1cccc(c1)S(=O)(=O)n1c2ccc(Br)cc2c2cc(ccc12)-c1cccc(c1)C(N)=N
Structure:
Search PDB for entries with ligand similarity: