Target
Sodium- and chloride-dependent GABA transporter 1
Ligand
BDBM50000102
Substrate
n/a
Meas. Tech.
ChEMBL_2086311 (CHEMBL4767574)
IC50
2951209±n/a nM
Citation
 Zar?ba, PGryz?o, BMalawska, KSa?at, KHöfner, GCNowaczyk, AFija?kowski, ?Rapacz, APodkowa, AFurga?a, A?mudzki, PWanner, KTMalawska, BKulig, K Novel mouse GABA uptake inhibitors with enhanced inhibitory activity toward mGAT3/4 and their effect on pain threshold in mice. Eur J Med Chem 188:0 (2020) [PubMed]  Article 
Target
Name:
Sodium- and chloride-dependent GABA transporter 1
Synonyms:
GABA transporter | Gabt1 | Gat-1 | Gat1 | SC6A1_RAT | Slc6a1 | Solute carrier family 6 member 1
Type:
PROTEIN
Mol. Mass.:
67006.26
Organism:
Rattus norvegicus
Description:
ChEMBL_1472611
Residue:
599
Sequence:
MATDNSKVADGQISTEVSEAPVASDKPKTLVVKVQKKAGDLPDRDTWKGRFDFLMSCVGYAIGLGNVWRFPYLCGKNGGGAFLIPYFLTLIFAGVPLFLLECSLGQYTSIGGLGVWKLAPMFKGVGLAAAVLSFWLNIYYIVIISWAIYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSLVNTTNMTSAVVEFWERNMHQMTDGLDKPGQIRWPLAITLAIAWVLVYFCIWKGVGWTGKVVYFSATYPYIMLIILFFRGVTLPGAKEGILFYITPNFRKLSDSEVWLDAATQIFFSYGLGLGSLIALGSYNSFHNNVYRDSIIVCCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVTQLPISPLWAILFFSMLLMLGIDSQFCTVEGFITALVDEYPRLLRNRRELFIAAVCIVSYLIGLSNITQGGIYVFKLFDYYSASGMSLLFLVFFECVSISWFYGVNRFYDNIQEMVGSRPCIWWKLCWSFFTPIIVAGVFLFSAVQMTPLTMGSYVFPKWGQGVGWLMALSSMVLIPGYMAYMFLTLKGSLKQRLQVMIQPSEDIVRPENGPEQPQAGSSASKEAYI
  
Inhibitor
Name:
BDBM50000102
Synonyms:
3-aminopropanoic acidbeta-alanine | Alanine-beta | CHEMBL297569 | beta-alanine | beta-aminopropionic acid | omega-aminopropionic acid
Type:
Small organic molecule
Emp. Form.:
C3H7NO2
Mol. Mass.:
89.0932
SMILES:
NCCC(O)=O
Structure:
Search PDB for entries with ligand similarity: