Target
Stanniocalcin-1
Ligand
BDBM50579526
Substrate
n/a
Meas. Tech.
ChEMBL_2135458
IC50
13±n/a nM
Citation
 Turdi, HChao, HHangeland, JJAhmad, SMeng, WBrigance, RZhao, GWang, WMoore, FYe, XYMathur, AHou, XKempson, JWu, DRLi, YXAzzara, AVMa, ZChu, CHChen, LCullen, MJRooney, SHarvey, SKopcho, LPanemangelor, RAbell, LO'Malley, KKeim, WJDierks, EChang, SFoster, KApedo, AHarden, DDabros, MGao, QPelleymounter, MAWhaley, JMRobl, JACheng, DLawrence, RMDevasthale, P Screening Hit to Clinical Candidate: Discovery of BMS-963272, a Potent, Selective MGAT2 Inhibitor for the Treatment of Metabolic Disorders. J Med Chem 64:14773-14792 (2021) [PubMed]  Article
Target
Name:
Stanniocalcin-1
Synonyms:
STC | STC-1 | STC1 | Stanniocalcin-1
Type:
PROTEIN
Mol. Mass.:
27627.69
Organism:
Homo sapiens
Description:
ChEMBL_120405
Residue:
247
Sequence:
MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
  
Inhibitor
Name:
BDBM50579526
Synonyms:
CHEMBL4878564
Type:
Small organic molecule
Emp. Form.:
C26H25F6N5O2
Mol. Mass.:
553.4994
SMILES:
Cc1ccc(cc1)C1=C(c2nnn[nH]2)C(=O)N[C@@](C1)(c1ccc(OCCCCCC(F)(F)F)cc1)C(F)(F)F |r,c:8|
Structure:
Search PDB for entries with ligand similarity: