Target
Prostaglandin G/H synthase 1
Ligand
BDBM50153994
Substrate
n/a
Meas. Tech.
ChEMBL_305401 (CHEMBL833051)
IC50
>100000±n/a nM
Citation
 Beswick, PBingham, SBountra, CBrown, TBrowning, KCampbell, IChessell, IClayton, NCollins, SCorfield, JGuntrip, SHaslam, CLambeth, PLucas, FMathews, NMurkit, GNaylor, APegg, NPickup, EPlayer, HPrice, HStevens, AStratton, SWiseman, J Identification of 2,3-diaryl-pyrazolo[1,5-b]pyridazines as potent and selective cyclooxygenase-2 inhibitors. Bioorg Med Chem Lett 14:5445-8 (2004) [PubMed]  Article 
Target
Name:
Prostaglandin G/H synthase 1
Synonyms:
COX-1 | COX1 | Cyclooxygenase | Cyclooxygenase-1 | Cyclooxygenase-1 (COX-1) | PGH1_HUMAN | PTGS1 | Prostaglandin G/H synthase (cyclooxygenase)
Type:
Enzyme
Mol. Mass.:
68692.62
Organism:
Homo sapiens (Human)
Description:
P23219
Residue:
599
Sequence:
MSRSLLLWFLLFLLLLPPLPVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
  
Inhibitor
Name:
BDBM50153994
Synonyms:
3-(4-Methanesulfonyl-phenyl)-2-phenyl-pyrazolo[1,5-b]pyridazine | CHEMBL365865
Type:
Small organic molecule
Emp. Form.:
C19H15N3O2S
Mol. Mass.:
349.406
SMILES:
CS(=O)(=O)c1ccc(cc1)-c1c(nn2ncccc12)-c1ccccc1
Structure:
Search PDB for entries with ligand similarity: