Target
Cathepsin B
Ligand
BDBM419133
Substrate
n/a
Meas. Tech.
ChEMBL_2213565 (CHEMBL5126697)
IC50
1400±n/a nM
Citation
 Bai, BArutyunova, EKhan, MBLu, JJoyce, MASaffran, HAShields, JAKandadai, ASBelovodskiy, AHena, MVuong, WLamer, TYoung, HSVederas, JCTyrrell, DLLemieux, MJNieman, JA Peptidomimetic nitrile warheads as SARS-CoV-2 3CL protease inhibitors. RSC Med Chem 12:1722-1730 (2021) [PubMed] 
Target
Name:
Cathepsin B
Synonyms:
APP secretase | APPS | CATB_HUMAN | CPSB | CTSB | Cathepsin B heavy chain | Cathepsin B light chain | Cathepsin B1
Type:
Enzyme
Mol. Mass.:
37819.69
Organism:
Homo sapiens (Human)
Description:
gi_63102437
Residue:
339
Sequence:
MWQLWASLCCLLVLANARSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
  
Inhibitor
Name:
BDBM419133
Synonyms:
BDBM429386 | GC376
Type:
Small organic molecule
Emp. Form.:
C21H30N3O8S
Mol. Mass.:
484.544
SMILES:
CC(C)C[C@H](NC(=O)OCc1ccccc1)C(=O)N[C@@H](C[C@@H]1CCNC1=O)C(O)S([O-])(=O)=O
Structure:
Search PDB for entries with ligand similarity: