Target
Cannabinoid receptor 2
Ligand
BDBM50170333
Substrate
n/a
Meas. Tech.
ChEMBL_310415 (CHEMBL834042)
EC50
24.4±n/a nM
Citation
 Huffman, JWSzklennik, PVAlmond, ABushell, KSelley, DEHe, HCassidy, MPWiley, JLMartin, BR 1-Pentyl-3-phenylacetylindoles, a new class of cannabimimetic indoles. Bioorg Med Chem Lett 15:4110-3 (2005) [PubMed]  Article 
Target
Name:
Cannabinoid receptor 2
Synonyms:
CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
39690.94
Organism:
Homo sapiens (Human)
Description:
P34972
Residue:
360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
  
Inhibitor
Name:
BDBM50170333
Synonyms:
2-(3-Methoxy-phenyl)-1-(1-pentyl-1H-indol-3-yl)-ethanone | 2-(3-methoxyphenyl)-1-(1-pentyl-1H-indol-3-yl)ethanone | CHEMBL186674 | JWH-302
Type:
Small organic molecule
Emp. Form.:
C22H25NO2
Mol. Mass.:
335.4394
SMILES:
CCCCCn1cc(C(=O)Cc2cccc(OC)c2)c2ccccc12
Structure:
Search PDB for entries with ligand similarity: