Target
Reverse transcriptase/RNaseH
Ligand
BDBM50172750
Substrate
n/a
Meas. Tech.
ChEMBL_321416 (CHEMBL881947)
IC50
31900±n/a nM
Citation
 Bedoya, LMBeltrán, MSancho, ROlmedo, DASánchez-Palomino, Sdel Olmo, ELópez-Pérez, JLMuñoz, ESan Feliciano, AAlcamí, J 4-Phenylcoumarins as HIV transcription inhibitors. Bioorg Med Chem Lett 15:4447-50 (2005) [PubMed]  Article 
Target
Name:
Reverse transcriptase/RNaseH
Synonyms:
HIV-1 Reverse Transcriptase RNase H | Human immunodeficiency virus type 1 reverse transcriptase | Reverse transcriptase/RNaseH
Type:
PROTEIN
Mol. Mass.:
65229.15
Organism:
Human immunodeficiency virus 1
Description:
ChEMBL_1473730
Residue:
566
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKRKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLRTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIRKVLFLDGID
  
Inhibitor
Name:
BDBM50172750
Synonyms:
5,7-Dihydroxy-8-isobutyryl-6-(3-methyl-but-2-enyl)-4-phenyl-chromen-2-one | CHEMBL383592 | isomesuol
Type:
Small organic molecule
Emp. Form.:
C24H24O5
Mol. Mass.:
392.4444
SMILES:
[#6]-[#6](-[#6])-[#6](=O)-c1c(-[#8])c(-[#6]\[#6]=[#6](\[#6])-[#6])c(-[#8])c2c(cc(=O)oc12)-c1ccccc1
Structure:
Search PDB for entries with ligand similarity: