Target
Muscleblind-like protein 1
Ligand
BDBM15236
Substrate
n/a
Meas. Tech.
ChEMBL_2265571
Kd
0.250000±n/a nM
Citation
 Ahamad, SBhat, SA The Emerging Landscape of Small-Molecule Therapeutics for the Treatment of Huntington's Disease. J Med Chem 65:15993-16032 (2022) [PubMed] 
Target
Name:
Muscleblind-like protein 1
Synonyms:
EXP | KIAA0428 | MBNL | MBNL1 | Muscleblind-like protein 1 | Triplet-expansion RNA-binding protein
Type:
PROTEIN
Mol. Mass.:
41833.94
Organism:
Homo sapiens
Description:
ChEMBL_103750
Residue:
388
Sequence:
MAVSVTPIRDTKWLTLEVCREFQRGTCSRPDTECKFAHPSKSCQVENGRVIACFDSLKGRCSRENCKYLHPPPHLKTQLEINGRNNLIQQKNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPAAAAAAAQKLMRTDRLEVCREYQRGNCNRGENDCRFAHPADSTMIDTNDNTVTVCMDYIKGRCSREKCKYFHPPAHLQAKIKAAQYQVNQAAAAQAAATAAAMTQSAVKSLKRPLEATFDLGIPQAVLPPLPKRPALEKTNGATAVFNTGIFQYQQALANMQLQQHTAFLPPVPMVHGATPATVSAATTSATSVPFAATATANQIPIISAEHLTSHKYVTQM
  
Inhibitor
Name:
BDBM15236
Synonyms:
3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)-4H-chromen-4-one | 3,5,7-trihydroxy-2-(3,4,5-trihydroxyphenyl)chromen-4-one | CHEMBL164 | Cannabiscetin | Myricetin | Myricetin (20) | Myricetin (Myr) | cid_5281672
Type:
Small organic molecule
Emp. Form.:
C15H10O8
Mol. Mass.:
318.2351
SMILES:
Oc1cc(O)c2c(c1)oc(-c1cc(O)c(O)c(O)c1)c(O)c2=O
Structure:
Search PDB for entries with ligand similarity: