Target
Delta-type opioid receptor
Ligand
BDBM50194488
Substrate
n/a
Meas. Tech.
ChEMBL_424404
Ki
18.8±n/a nM
Citation
 Shiotani, KLi, TMiyazaki, ATsuda, YBryant, SDAmbo, ASasaki, YLazarus, LHOkada, Y Synthesis of 3,6-bis[H-Tyr/H-Dmt-NH(CH2)m,n]-2(1H)pyrazinone derivatives: function of alkyl chain length on opioid activity. Bioorg Med Chem Lett 16:5793-6 (2006) [PubMed]  Article
Target
Name:
Delta-type opioid receptor
Synonyms:
Cytochrome P450 3A4 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor | Delta-type opioid receptor (DOR) | OPIATE Delta | Opiate Delta 1 | Opioid receptor | Opioid receptor A | Opioid receptors; mu & delta | Voltage-gated potassium channel
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
40465.04
Organism:
Rattus norvegicus (rat)
Description:
Competition binding assays were using CHO-K1 cell membranes expressing the opioid receptor.
Residue:
372
Sequence:
MEPVPSARAELQFSLLANVSDTFPSAFPSASANASGSPGARSASSLALAIAITALYSAVCAVGLLGNVLVMFGIVRYTKLKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELLCKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVGVPIMVMAVTQPRDGAVVCTLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRLRSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDINRRDPLVVAALHLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRAPCGGQEPGSLRRPRQATARERVTACTPSDGPGGGAAA
  
Inhibitor
Name:
BDBM50194488
Synonyms:
6-[4'-(H-Dmt)-aminobutyl]-3-[3'-(H-Dmt)-aminopropyl]-5-methyl-2(1H)-pyrazinone | CHEMBL385779
Type:
Small organic molecule
Emp. Form.:
C34H48N6O5
Mol. Mass.:
620.7821
SMILES:
Cc1cc(O)cc(C)c1C[C@H](N)C(=O)NCCCCc1[nH]c(=O)c(CCCNC(=O)[C@@H](N)Cc2c(C)cc(O)cc2C)nc1C
Structure:
Search PDB for entries with ligand similarity: