Target
Peroxisome proliferator-activated receptor alpha
Ligand
BDBM50194979
Substrate
n/a
Meas. Tech.
ChEMBL_424613 (CHEMBL853964)
EC50
9400±n/a nM
Citation
 Humphries, PSBailey, SAlmaden, JVBarnum, SJCarlson, TJChristie, LCDo, QQFraser, JDHess, MKellum, JKim, YHMcClellan, GAOgilvie, KMSimmons, BHSkalitzky, DSun, SWilhite, DZehnder, LR Pyridine-3-propanoic acids: Discovery of dual PPARalpha/gamma agonists as antidiabetic agents. Bioorg Med Chem Lett 16:6120-3 (2006) [PubMed]  Article 
Target
Name:
Peroxisome proliferator-activated receptor alpha
Synonyms:
NR1C1 | Nuclear receptor subfamily 1 group C member 1 | PPAR | PPAR alpha/gamma | PPAR-alpha | PPARA | PPARA_HUMAN | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Type:
Enzyme
Mol. Mass.:
52222.08
Organism:
Homo sapiens (Human)
Description:
Q07869
Residue:
468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
  
Inhibitor
Name:
BDBM50194979
Synonyms:
3,3-dimethyl-2-((6-(2-(5-methyl-2-phenyloxazol-4-yl)ethoxy)pyridin-3-yl)methyl)butanoic acid | CHEMBL221923
Type:
Small organic molecule
Emp. Form.:
C24H28N2O4
Mol. Mass.:
408.4901
SMILES:
Cc1oc(nc1CCOc1ccc(CC(C(O)=O)C(C)(C)C)cn1)-c1ccccc1
Structure:
Search PDB for entries with ligand similarity: