Target
Mitogen-activated protein kinase 14
Ligand
BDBM50252780
Substrate
n/a
Meas. Tech.
ChEMBL_539857 (CHEMBL1024853)
IC50
182±n/a nM
Citation
 Herberich, BCao, GQChakrabarti, PPFalsey, JRPettus, LRzasa, RMReed, ABReichelt, ASham, KThaman, MWurz, RPXu, SZhang, DHsieh, FLee, MRSyed, RLi, VGrosfeld, DPlant, MHHenkle, BSherman, LMiddleton, SWong, LMTasker, AS Discovery of highly selective and potent p38 inhibitors based on a phthalazine scaffold. J Med Chem 51:6271-9 (2008) [PubMed]  Article 
Target
Name:
Mitogen-activated protein kinase 14
Synonyms:
CSAID-binding protein | CSBP | CSBP1 | CSBP2 | CSPB1 | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAPK14 | MAX-interacting protein 2 | MK14_HUMAN | MXI2 | Mitogen-activated protein kinase p38 alpha | SAPK2A | Stress-activated protein kinase 2a | p38 MAP kinase alpha/beta
Type:
Serine/threonine-protein kinase
Mol. Mass.:
41286.76
Organism:
Homo sapiens (Human)
Description:
Q16539
Residue:
360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
  
Inhibitor
Name:
BDBM50252780
Synonyms:
CHEMBL494470 | N-Cyclopropyl-3-(1-(4-morpholinyl)-6-phthalazinyl)benzamide
Type:
Small organic molecule
Emp. Form.:
C22H22N4O2
Mol. Mass.:
374.4357
SMILES:
O=C(NC1CC1)c1cccc(c1)-c1ccc2c(nncc2c1)N1CCOCC1
Structure:
Search PDB for entries with ligand similarity: