Target
5-hydroxytryptamine receptor 4
Ligand
BDBM50413526
Substrate
n/a
Meas. Tech.
ChEMBL_564555 (CHEMBL963182)
Ki
416.87±n/a nM
Citation
 Lemaître, SLepailleur, ABureau, RButt-Gueulle, SLelong-Boulouard, VDuchatelle, PBoulouard, MDumuis, ADaveu, CLezoualc'h, FPfeiffer, BDauphin, FRault, S Novel antagonists of serotonin-4 receptors: synthesis and biological evaluation of pyrrolothienopyrazines. Bioorg Med Chem 17:2607-22 (2009) [PubMed]  Article 
Target
Name:
5-hydroxytryptamine receptor 4
Synonyms:
5-HT4 | 5-hydroxytryptamine receptor 4 | 5HT4R_CAVPO | HTR4 | Serotonin 4 (5-HT4) receptor
Type:
Enzyme Catalytic Domain
Mol. Mass.:
43735.29
Organism:
GUINEA PIG
Description:
5-HT4 HTR4 GUINEA PIG::O70528
Residue:
388
Sequence:
MDKLDANVSSKEGFGSVEKVVLLTFLSAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWVYGEMFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPMFISFLPIMQGWNNIGIVDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHARQIQVLQRAGAPAEGRPQPADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQLWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDTVECGGQWESQCHPAASSPLVAAQPIDT
  
Inhibitor
Name:
BDBM50413526
Synonyms:
CHEMBL513740
Type:
Small organic molecule
Emp. Form.:
C16H19N3OS
Mol. Mass.:
301.407
SMILES:
C(CN1CCCCC1)Oc1nc2ccsc2n2cccc12
Structure:
Search PDB for entries with ligand similarity: