Target
Cysteinyl leukotriene receptor 1
Ligand
BDBM50286254
Substrate
n/a
Meas. Tech.
ChEBML_99860
IC50
0.580000±n/a nM
Citation
 Labelle, MBelley, MGareau, YGauthier, JYGuay, DGordon, RGrossman, SGJones, TRLeblanc, YMcAuliffe, MMcFarlane, CMasson, PMetters, KMOuimet, NPatrick, DHPiechuta, HRochette, CSawyer, NXiang, YBPickett, CB Discovery of MK-0476, a potent and orally active leukotriene D4 receptor antagonist devoid of peroxisomal enxyme induction Bioorg Med Chem Lett 5:283-288 (1995)    Article 
Target
Name:
Cysteinyl leukotriene receptor 1
Synonyms:
CLTR1_CAVPO | CYSLTR1
Type:
Enzyme Catalytic Domain
Mol. Mass.:
39007.58
Organism:
GUINEA PIG
Description:
Leukotriene D4 0 GUINEA PIG::Q2NNR5
Residue:
340
Sequence:
MDETGNPTIPPASNNTCYDSIDDFRNQVYSTLYSMISVVGFFGNGFVLYVLVKTYHEKSAFQVYMINLAVADLLCVCTLPLRVAYYVHKGIWLFGDFLCRLSTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNISLVTQKKARLVCIAIWMFVILTSSPFLMANTYKDEKNNTKCFEPPQDNQAKNYVLILHYVSLFIGFIIPFITIIVCYTMIIFTLLKSSMKKNLSSRKRAIGMIIVVTAAFLVSFMPYHIQRTIHLHFLHNKTKPCDSILRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTIRKYSLSSMTYIPKKKTSLPQKGKDICKE
  
Inhibitor
Name:
BDBM50286254
Synonyms:
3-{(R)-1-{3-[(E)-2-(7-Chloro-quinolin-2-yl)-vinyl]-phenyl}-3-[2-(1-hydroxy-1-methyl-ethyl)-phenyl]-propylsulfanyl}-pentanoic acid | CHEMBL95362
Type:
Small organic molecule
Emp. Form.:
C34H36ClNO3S
Mol. Mass.:
574.173
SMILES:
CCC(CC(O)=O)S[C@H](CCc1ccccc1C(C)(C)O)c1cccc(\C=C\c2ccc3ccc(Cl)cc3n2)c1
Structure:
Search PDB for entries with ligand similarity: