Target
Peroxisome proliferator-activated receptor alpha
Ligand
BDBM50314819
Substrate
n/a
Meas. Tech.
ChEMBL_627233 (CHEMBL1110802)
EC50
134±n/a nM
Citation
 Li, JKennedy, LJShi, YTao, SYe, XYChen, SYWang, YHernández, ASWang, WDevasthale, PVChen, SLai, ZZhang, HWu, SSmirk, RABolton, SARyono, DEZhang, HLim, NKChen, BCLocke, KTO'Malley, KMZhang, LSrivastava, RAMiao, BMeyers, DSMonshizadegan, HSearch, DGrimm, DZhang, RHarrity, TKunselman, LKCap, MKadiyala, PHosagrahara, VZhang, LXu, CLi, YXMuckelbauer, JKChang, CAn, YKrystek, SRBlanar, MAZahler, RMukherjee, RCheng, PTTino, JA Discovery of an oxybenzylglycine based peroxisome proliferator activated receptor alpha selective agonist 2-((3-((2-(4-chlorophenyl)-5-methyloxazol-4-yl)methoxy)benzyl)(methoxycarbonyl)amino)acetic acid (BMS-687453). J Med Chem 53:2854-64 (2010) [PubMed]  Article 
Target
Name:
Peroxisome proliferator-activated receptor alpha
Synonyms:
NR1C1 | Nuclear receptor subfamily 1 group C member 1 | PPAR | PPAR alpha/gamma | PPAR-alpha | PPARA | PPARA_HUMAN | Peroxisome Proliferator-Activated Receptor alpha | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor alpha (PPAR alpha)
Type:
Enzyme
Mol. Mass.:
52222.08
Organism:
Homo sapiens (Human)
Description:
Q07869
Residue:
468
Sequence:
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
  
Inhibitor
Name:
BDBM50314819
Synonyms:
2-((3-((2-(3-chlorophenyl)-5-methyloxazol-4-yl)methoxy)benzyl)(ptolyloxycarbonyl)amino)acetic acid | CHEMBL1092931
Type:
Small organic molecule
Emp. Form.:
C28H25ClN2O6
Mol. Mass.:
520.961
SMILES:
Cc1oc(nc1COc1cccc(CN(CC(O)=O)C(=O)Oc2ccc(C)cc2)c1)-c1cccc(Cl)c1
Structure:
Search PDB for entries with ligand similarity: