Target
Neuropeptide Y receptor type 1
Ligand
BDBM50343731
Substrate
n/a
Meas. Tech.
ChEMBL_747562
Ki
0.25±n/a nM
Citation
 Keller, MErdmann, DPop, NPluym, NTeng, SBernhardt, GBuschauer, A Red-fluorescent argininamide-type NPY Y1 receptor antagonists as pharmacological tools. Bioorg Med Chem 19:2859-78 (2011) [PubMed]  Article
Target
Name:
Neuropeptide Y receptor type 1
Synonyms:
NPY-Y1 | NPY1-R | neuropeptide Y receptor Y1
Type:
Enzyme Catalytic Domain
Mol. Mass.:
44399.07
Organism:
Homo sapiens (Human)
Description:
NPY-Y1 NPY1R HUMAN::P25929
Residue:
384
Sequence:
MNSTLFSQVENHSVHSNFSEKNAQLLAFENDDCHLPLAMIFTLALAYGAVIILGVSGNLALIIIILKQKEMRNVTNILIVNLSFSDLLVAIMCLPFTFVYTLMDHWVFGEAMCKLNPFVQCVSITVSIFSLVLIAVERHQLIINPRGWRPNNRHAYVGIAVIWVLAVASSLPFLIYQVMTDEPFQNVTLDAYKDKYVCFDQFPSDSHRLSYTTLLLVLQYFGPLCFIFICYFKIYIRLKRRNNMMDKMRDNKYRSSETKRINIMLLSIVVAFAVCWLPLTIFNTVFDWNHQIIATCNHNLLFLLCHLTAMISTCVNPIFYGFLNKNFQRDLQFFFNFCDFRSRDDDYETIAMSTMHTDVSKTSLKQASPVAFKKINNNDDNEKI
  
Inhibitor
Name:
BDBM50343731
Synonyms:
(R)-N-alpha-(2,2-Diphenylacetyl)-N-(4-ureidomethylbenzyl)argininamide | CHEMBL1774204
Type:
Small organic molecule
Emp. Form.:
C29H35N7O3
Mol. Mass.:
529.6333
SMILES:
[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#6]-[#6@@H](-[#7]-[#6](=O)-[#6](-c1ccccc1)-c1ccccc1)-[#6](=O)-[#7]-[#6]-c1ccc(-[#6]-[#7]-[#6](-[#7])=O)cc1 |r|
Structure:
Search PDB for entries with ligand similarity: