Target
5-hydroxytryptamine receptor 2C
Ligand
BDBM50399623
Substrate
n/a
Meas. Tech.
ChEMBL_878524
Ki
772±n/a nM
Citation
 Dubost, EDumas, NFossey, CMagnelli, RButt-Gueulle, SBallandonne, CCaignard, DHDulin, FSopkova de-Oliveira Santos, JMillet, PCharnay, YRault, SCailly, TFabis, F Synthesis and structure-affinity relationships of selective high-affinity 5-HT(4) receptor antagonists: application to the design of new potential single photon emission computed tomography tracers. J Med Chem 55:9693-707 (2012) [PubMed]  Article
Target
Name:
5-hydroxytryptamine receptor 2C
Synonyms:
5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
51836.79
Organism:
Homo sapiens (Human)
Description:
P28335
Residue:
458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
  
Inhibitor
Name:
BDBM50399623
Synonyms:
CHEMBL2181169
Type:
Small organic molecule
Emp. Form.:
C22H25IN2O
Mol. Mass.:
460.3512
SMILES:
CCCN1CCC(COc2nc3c(I)cccc3c3ccccc23)CC1
Structure:
Search PDB for entries with ligand similarity: