Target
5-hydroxytryptamine receptor 2C
Ligand
BDBM50408155
Substrate
n/a
Meas. Tech.
ChEMBL_2784
IC50
13803.84±n/a nM
Citation
 Prunier, HRault, SLancelot, JCRobba, MRenard, PDelagrange, PPfeiffer, BCaignard, DHMisslin, RGuardiola-Lemaitre, BHamon, M Novel and selective partial agonists of 5-HT3 receptors. 2. Synthesis and biological evaluation of piperazinopyridopyrrolopyrazines, piperazinopyrroloquinoxalines, and piperazinopyridopyrroloquinoxalines. J Med Chem 40:1808-19 (1997) [PubMed]  Article
Target
Name:
5-hydroxytryptamine receptor 2C
Synonyms:
5-HT-2C | 5-HT2C | 5-HT2C-INI | 5-HT2c VGI | 5-HTR2C | 5-hydroxytryptamine receptor 1C | 5-hydroxytryptamine receptor 2C (5-HT-2C) | 5-hydroxytryptamine receptor 2C (5HT-2C) | 5HT-1C | HTR1C | HTR2C | Serotonin (5-HT3) receptor | Serotonin 2c (5-HT2c) receptor | Serotonin Receptor 2C
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
51836.79
Organism:
Homo sapiens (Human)
Description:
P28335
Residue:
458
Sequence:
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
  
Inhibitor
Name:
BDBM50408155
Synonyms:
CHEMBL54125
Type:
Small organic molecule
Emp. Form.:
C22H21FN4
Mol. Mass.:
360.4273
SMILES:
Fc1ccc(CN2CCN(CC2)c2nc3ccccc3n3cccc23)cc1
Structure:
Search PDB for entries with ligand similarity: