Target
Cannabinoid receptor 2
Ligand
BDBM50170333
Substrate
n/a
Meas. Tech.
ChEMBL_570539 (CHEMBL1026911)
Ki
89.13±n/a nM
Citation
 De Freitas, GBda Silva, LLRomeiro, NCFraga, CA Development of CoMFA and CoMSIA models of affinity and selectivity for indole ligands of cannabinoid CB1 and CB2 receptors. Eur J Med Chem 44:2482-96 (2009) [PubMed]  Article 
Target
Name:
Cannabinoid receptor 2
Synonyms:
CANNABINOID CB2 | CB-2 | CB2 | CB2A | CB2B | CNR2 | CNR2_HUMAN | CX5 | Cannabinoid CB2 receptor | Cannabinoid receptor 2 (CB2) | Cannabinoid receptor 2 (CB2R) | hCB2
Type:
G Protein-Coupled Receptor (GPCR)
Mol. Mass.:
39690.94
Organism:
Homo sapiens (Human)
Description:
P34972
Residue:
360
Sequence:
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
  
Inhibitor
Name:
BDBM50170333
Synonyms:
2-(3-Methoxy-phenyl)-1-(1-pentyl-1H-indol-3-yl)-ethanone | 2-(3-methoxyphenyl)-1-(1-pentyl-1H-indol-3-yl)ethanone | CHEMBL186674 | JWH-302
Type:
Small organic molecule
Emp. Form.:
C22H25NO2
Mol. Mass.:
335.4394
SMILES:
CCCCCn1cc(C(=O)Cc2cccc(OC)c2)c2ccccc12
Structure:
Search PDB for entries with ligand similarity: