Target
Arginase-1
Ligand
BDBM50427900
Substrate
n/a
Meas. Tech.
ChEMBL_940977
IC50
3000±n/a nM
Citation
 Van Zandt, MCWhitehouse, DLGolebiowski, AJi, MKZhang, MBeckett, RPJagdmann, GERyder, TRSheeler, RAndreoli, MConway, BMahboubi, KD'Angelo, GMitschler, ACousido-Siah, ARuiz, FXHoward, EIPodjarny, ADSchroeter, H Discovery of (R)-2-amino-6-borono-2-(2-(piperidin-1-yl)ethyl)hexanoic acid and congeners as highly potent inhibitors of human arginases I and II for treatment of myocardial reperfusion injury. J Med Chem 56:2568-80 (2013) [PubMed]  Article
Target
Name:
Arginase-1
Synonyms:
ARG1 | Liver-type arginase | Type I arginase
Type:
PROTEIN
Mol. Mass.:
34737.53
Organism:
Homo sapiens (Human)
Description:
ChEMBL_978893
Residue:
322
Sequence:
MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK
  
Inhibitor
Name:
BDBM50427900
Synonyms:
(R)-2-amino-6-borono-2-[2-(piperidin-1-yl)ethyl]hexanoic acid (ABH-PE) | CHEMBL2326089
Type:
Small organic molecule
Emp. Form.:
C13H27BN2O4
Mol. Mass.:
286.175
SMILES:
N[C@](CCCCB(O)O)(CCN1CCCCC1)C(O)=O |r|
Structure:
Search PDB for entries with ligand similarity: