Target
Serine/threonine-protein kinase pim-3
Ligand
BDBM50437434
Substrate
n/a
Meas. Tech.
ChEMBL_972721 (CHEMBL2410930)
IC50
150±n/a nM
Citation
 Dowling, JEAlimzhanov, MBao, LBlock, MHChuaqui, CCooke, ELDenz, CRHird, AHuang, SLarsen, NAPeng, BPontz, TWRivard-Costa, CSaeh, JCThakur, KYe, QZhang, TLyne, PD Structure and Property Based Design of Pyrazolo[1,5-a]pyrimidine Inhibitors of CK2 Kinase with Activity in Vivo. ACS Med Chem Lett 4:800-5 (2013) [PubMed]  Article 
Target
Name:
Serine/threonine-protein kinase pim-3
Synonyms:
PIM3 | PIM3_HUMAN | Serine/threonine-protein kinase pim-3 (PIM3)
Type:
Protein
Mol. Mass.:
35888.19
Organism:
Homo sapiens (Human)
Description:
Q86V86
Residue:
326
Sequence:
MLLSKFGSLAHLCGPGGVDHLPVKILQPAKADKESFEKAYQVGAVLGSGGFGTVYAGSRIADGLPVAVKHVVKERVTEWGSLGGATVPLEVVLLRKVGAAGGARGVIRLLDWFERPDGFLLVLERPEPAQDLFDFITERGALDEPLARRFFAQVLAAVRHCHSCGVVHRDIKDENLLVDLRSGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSATVWSLGVLLYDMVCGDIPFEQDEEILRGRLLFRRRVSPECQQLIRWCLSLRPSERPSLDQIAAHPWMLGADGGVPESCDLRLCTLDPDDVASTTSSSESL
  
Inhibitor
Name:
BDBM50437434
Synonyms:
CHEMBL2409175
Type:
Small organic molecule
Emp. Form.:
C19H19N7O
Mol. Mass.:
361.4005
SMILES:
CC(=O)Nc1cc(Nc2cc(NC3CC3)n3ncc(C#N)c3n2)ccc1C
Structure:
Search PDB for entries with ligand similarity: