Target
Neuropeptide Y receptor type 4
Ligand
BDBM50343731
Substrate
n/a
Meas. Tech.
ChEMBL_990501
Ki
>5000±n/a nM
Citation
 Keller, MKaske, MHolzammer, TBernhardt, GBuschauer, A Dimeric argininamide-type neuropeptide Y receptor antagonists: chiral discrimination between Y1 and Y4 receptors. Bioorg Med Chem 21:6303-22 (2013) [PubMed]  Article
Target
Name:
Neuropeptide Y receptor type 4
Synonyms:
NPY-Y4 | NPY4-R | PP1 | PPYR1 | Pancreatic polypeptide receptor 1
Type:
Enzyme Catalytic Domain
Mol. Mass.:
42207.58
Organism:
Homo sapiens (Human)
Description:
NPY-Y4 PPYR1 HUMAN::P50391
Residue:
375
Sequence:
MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNLCLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSILENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRRLQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHGNLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTEVSKGSLRLSGRSNPI
  
Inhibitor
Name:
BDBM50343731
Synonyms:
(R)-N-alpha-(2,2-Diphenylacetyl)-N-(4-ureidomethylbenzyl)argininamide | CHEMBL1774204
Type:
Small organic molecule
Emp. Form.:
C29H35N7O3
Mol. Mass.:
529.6333
SMILES:
[#7]\[#6](-[#7])=[#7]\[#6]-[#6]-[#6]-[#6@@H](-[#7]-[#6](=O)-[#6](-c1ccccc1)-c1ccccc1)-[#6](=O)-[#7]-[#6]-c1ccc(-[#6]-[#7]-[#6](-[#7])=O)cc1 |r|
Structure:
Search PDB for entries with ligand similarity: