Target
Cyclin-dependent kinase 4/G1/S-specific cyclin-D3
Ligand
BDBM467013
Substrate
n/a
Meas. Tech.
CDK4/Cyclin D3 Mobility Shift Assay
Ki
0.160±n/a nM
Citation
 Behenna, DCChen, PFreeman-Cook, KDHoffman, RLJalaie, MNagata, ANair, SKNinkovic, SOrnelas, MAPalmer, CLRui, EY CDK2/4/6 inhibitors US Patent  US10800783 Publication Date 10/13/2020
Target
Name:
Cyclin-dependent kinase 4/G1/S-specific cyclin-D3
Synonyms:
CDK4/Cyclin D3
Type:
n/a
Mol. Mass.:
n/a
Description:
ASSAY_ID of ChEMBL is 1806445
Components:
This complex has 2 components.
Component 1
Name:
Cyclin-dependent kinase 4
Synonyms:
CDK4 | Cell division protein kinase 4 | Cyclin-dependent kinase 4 (CDK 4) | PSK-J3
Type:
Enzyme Subunit
Mol. Mass.:
33731.96
Organism:
Homo sapiens (Human)
Description:
P11802
Residue:
303
Sequence:
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE
  
Component 2
Name:
G1/S-specific cyclin-D3
Synonyms:
CCND3
Type:
Enzyme
Mol. Mass.:
32521.90
Organism:
Homo sapiens (Human)
Description:
P30281
Residue:
292
Sequence:
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
  
Inhibitor
Name:
BDBM467013
Synonyms:
(-)-6-(2,2-difluoroethyl)-8-[(1R*,2R*)-2-hydroxy-2-methylcyclopentyl]-2-{[1-(methylsulfonyl)piperidin-4-yl]amino}pyrido[2,3-d]pyrimidin-7(8H)-one | US10800783, Example 8 | US11396512, Example 8
Type:
Small organic molecule
Emp. Form.:
C21H29F2N5O4S
Mol. Mass.:
485.548
SMILES:
C[C@@]1(O)CCC[C@H]1n1c2nc(NC3CCN(CC3)S(C)(=O)=O)ncc2cc(CC(F)F)c1=O |r|
Structure:
Search PDB for entries with ligand similarity: