Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVasopressin V2 receptor
LigandBDBM50452524
Substrate/Competitorn/a
Meas. Tech.ChEBML_214849
Ki 3.6±n/a nM
Citation Moore, MLAlbrightson, CBrickson, BBryan, HGCaldwell, NCallahan, JFFoster, JKinter, LBNewlander, KASchmidt, DB Dicarbavasopressin antagonist analogues exhibit reduced in vivo agonist activity. J Med Chem31:1487-9 (1988) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vasopressin V2 receptor
Name:Vasopressin V2 receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40556.17
Organism:Sus scrofa
Description:ChEMBL_214870
Residue:370
Sequence:
MLRATTSAVPRALSWPAAPGNGSEREPLDDRDPLLARVELALLSTVFVAVALSNGLVLGA
LVRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATYRFRGPDALCRAVKYLQMV
GMYASSYMILAMTLDRHRAICRPMLAYRHGGGARWNRPVLVAWAFSLLLSLPQLFIFAQR
DVGDGSGVLDCWASFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLVPGPA
ERAGGHRGGRRAGSPREGARVSAAMAKTARMTLVIVAVYVLCWAPFFLVQLWSVWDPKAP
REGPPFVLLMLLASLNSCTNPWIYASFSSSISSELRSLLCCPRRRTPPSLRPQEESCATA
SSFSARDTSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50452524
NameBDBM50452524
Synonyms:CHEMBL2372291
TypeSmall organic molecule
Emp. Form.C51H74N12O10S2
Mol. Mass.1079.338
SMILES[#6]-[#6]-[#8]-c1ccc(-[#6]-[#6@H]-2-[#7]-[#6](=O)-[#6]C3([#6]-[#6]-[#6]-[#6]-[#6]3)[#16]-[#16]-[#6]-[#6](-[#7]-[#6](=O)-[#6@H](-[#6]-[#6](-[#7])=O)-[#7]-[#6](=O)-[#6@@H](-[#7]-[#6](=O)-[#6@H](-[#6]-c3ccccc3)-[#7]-[#6]-2=O)-[#6](-[#6])-[#6])-[#6](=O)-[#7]-2-[#6]-[#6]-[#6]-[#6@@H]-2-[#6](=O)-[#7]-[#6@@H](-[#6]-[#6]-[#6]\[#7]=[#6](\[#7])-[#7])-[#6](-[#7])=O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a