Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCasein Kinase II
LigandBDBM50335638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_714648
IC50 1±n/a nM
Citation Pierre, FChua, PCO'Brien, SESiddiqui-Jain, ABourbon, PHaddach, MMichaux, JNagasawa, JSchwaebe, MKStefan, EVialettes, AWhitten, JPChen, TKDarjania, LStansfield, RAnderes, KBliesath, JDrygin, DHo, COmori, MProffitt, CStreiner, NTrent, KRice, WGRyckman, DM Discovery and SAR of 5-(3-chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid (CX-4945), the first clinical stage inhibitor of protein kinase CK2 for the treatment of cancer. J Med Chem54:635-54 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Casein Kinase II
Name:Casein kinase II alpha/beta
Synonyms:CK II | CK2 | CK2- alpha | Casein kinase II (CK2) | Casein kinase II alpha | Casein kinase II alpha/beta | Casein kinase II subunit alpha | Casein kinase II subunit alpha (CK2 alpha) | Casein kinase II subunit alpha (CK2α) | Casein kinase II subunit alpha (CK2A1) | Casein kinase II subunit alpha (CK2a I174A) | Casein kinase II subunit alpha (CK2a V66A) | Casein kinase II subunit alpha (CK2a dm V66I174AA) | Casein kinase II subunit alpha (CK2a)
Type:Enzyme Mixture
Mol. Mass.:45151.12
Organism:Homo sapiens (human)
Description:Recombinant full-length human Casein Kinase 2 protein, containing an alpha subunit N-terminal His6 tag and a beta subunit N-terminal GST tag. The proteins were expressed by baculovirus in insect cells.
Residue:391
Sequence:
MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKLGRGKYSEVFEAINIT
NNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDPVSRTPALVFEHVNNTD
FKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVMIDHEHRKLRLIDWGLAE
FYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRKEPFFHGHDNYD
QLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRWERFVHSENQHLVSPEALDF
LDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMGSSSMPGGSTPVSSANMMSGISSVPT
PSPLGPLAGSPVIAAANPLGMPVPAAAGAQQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335638
NameBDBM50335638
Synonyms:5-(3-Chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid | 5-[(3-chlorophenyl)amino]benzo[c][2,6]naphthyridine-8-carboxylic acid | CHEMBL1230165 | US9062043, Table 13, Compound 17 | US9062043, Table 20b, Compound 12
TypeSmall organic molecule
Emp. Form.C19H12ClN3O2
Mol. Mass.349.77
SMILESOC(=O)c1ccc2c(c1)nc(Nc1cccc(Cl)c1)c1ccncc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a