Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDeath-associated protein kinase 3
LigandBDBM50335638
Substrate/Competitorn/a
Meas. Tech.ChEMBL_714650
IC50 17±n/a nM
Citation Pierre, FChua, PCO'Brien, SESiddiqui-Jain, ABourbon, PHaddach, MMichaux, JNagasawa, JSchwaebe, MKStefan, EVialettes, AWhitten, JPChen, TKDarjania, LStansfield, RAnderes, KBliesath, JDrygin, DHo, COmori, MProffitt, CStreiner, NTrent, KRice, WGRyckman, DM Discovery and SAR of 5-(3-chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid (CX-4945), the first clinical stage inhibitor of protein kinase CK2 for the treatment of cancer. J Med Chem54:635-54 (2011) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Death-associated protein kinase 3
Name:Death-associated protein kinase 3
Synonyms:DAP kinase 3 | DAP-like kinase | DAPK3 | ZIP-kinase
Type:PROTEIN
Mol. Mass.:52537.07
Organism:Homo sapiens
Description:ChEMBL_586564
Residue:454
Sequence:
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTT
RLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIY
EEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50335638
NameBDBM50335638
Synonyms:5-(3-Chlorophenylamino)benzo[c][2,6]naphthyridine-8-carboxylic acid | 5-[(3-chlorophenyl)amino]benzo[c][2,6]naphthyridine-8-carboxylic acid | CHEMBL1230165 | US9062043, Table 13, Compound 17 | US9062043, Table 20b, Compound 12
TypeSmall organic molecule
Emp. Form.C19H12ClN3O2
Mol. Mass.349.77
SMILESOC(=O)c1ccc2c(c1)nc(Nc1cccc(Cl)c1)c1ccncc21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a