Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCytochrome P450 19A1
LigandBDBM50024513
Substrate/Competitorn/a
Meas. Tech.ChEBML_51214
EC50 140±n/a nM
Citation Taylor, HMJones, CDDavenport, JDHirsch, KSKress, TJWeaver, D Aromatase inhibition by 5-substituted pyrimidines and dihydropyrimidines. J Med Chem30:1359-65 (1987) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cytochrome P450 19A1
Name:Cytochrome P450 19A1
Synonyms:Aromatase | CYPXIX | Estrogen synthetase | P-450AROM
Type:PROTEIN
Mol. Mass.:58418.09
Organism:Rattus norvegicus
Description:ChEMBL_51211
Residue:508
Sequence:
MFLEMLNPMHYNVTIMVPETVPVSAMPLLLIMGLLLLIRNCESSSSIPGPGYCLGIGPLI
SHGRFLWMGIGSACNYYNKMYGEFMRVWISGEETLIISKSSSMVHVMKHSNYISRFGSKR
GLQCIGMHENGIIFNNNPSLWRTVRPFFMKALTGPGLIRMVEVCVESIKQHLDRLGDVTD
NSGYVDVVTLMRHIMLDTSNTLFLGIPLDESSIVKKIQGYFNAWQALLIKPNIFFKISWL
YRKYERSVKDLKDEIEILVEKKRQKVSSAEKLEDCMDFATDLIFAERRGDLTKENVNQCI
LEMLIAAPDTMSVTLYVMLLLIAEYPEVETAILKEIHTVVGDRDIRIGDVQNLKVVENFI
NESLRYQPVVDLVMRRALEDDVIDGYPVKKGTNIILNIGRMHRLEYFPKPNEFTLENFEK
NVPYRYFQPFGFGPRSCAGKYIAMVMMKVVLVTLLKRFHVKTLQKRCIENMPKNNDLSLH
LDEDSPIVEIIFRHIFNTPFLQCLYISL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50024513
NameBDBM50024513
Synonyms:6-Acetylsulfanyl-8-[2-[(4-amino-2-methyl-pyrimidin-5-ylmethyl)-formyl-amino]-1-(2-hydroxy-ethyl)-propenyldisulfanyl]-octanoic acid methyl ester(ATD) | CHEMBL285358
TypeSmall organic molecule
Emp. Form.C23H36N4O5S3
Mol. Mass.544.751
SMILESCOC(=O)CCCCC(CCSS\C(CCO)=C(/C)N(Cc1cnc(C)nc1N)C=O)SC(C)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a