Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 6
LigandBDBM50148348
Substrate/Competitorn/a
Meas. Tech.ChEMBL_946255
EC50 970±n/a nM
Citation Jiang, GInoue, AAoki, JPrestwich, GD Phosphorothioate analogs of sn-2 radyl lysophosphatidic acid (LPA): metabolically stabilized LPA receptor agonists. Bioorg Med Chem Lett23:1865-9 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 6
Name:Lysophosphatidic acid receptor 6
Synonyms:LPA receptor 6 | LPA-6 | LPAR6 | Oleoyl-L-alpha-lysophosphatidic acid receptor | P2RY5 | P2Y purinoceptor 5 | P2Y5 | Purinergic receptor 5 | RB intron encoded G-protein coupled receptor
Type:PROTEIN
Mol. Mass.:39408.81
Organism:Homo sapiens
Description:ChEMBL_946255
Residue:344
Sequence:
MVSVNSSHCFYNDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICVLKVRNETTTYMINLA
MSDLLFVFTLPFRIFYFTTRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY
PFKSKTLRTKRNAKIVCTGVWLTVIGGSAPAVFVQSTHSQGNNASEACFENFPEATWKTY
LSRIVIFIEIVGFFIPLILNVTCSSMVLKTLTKPVTLSRSKINKTKVLKMIFVHLIIFCF
CFVPYNINLILYSLVRTQTFVNCSVVAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN
SIKMKNWSVRRSDFRFSEVHGAENFIQHNLQTLKSKIFDNESAA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50148348
NameBDBM50148348
Synonyms:(R)-Octadec-9-enoic acid 2-hydroxy-3-phosphonooxy-propyl ester | 1-oleoyl lysophosphatidic acid | CHEMBL117021 | lysophosphatidic acid
TypeSmall organic molecule
Emp. Form.C21H41O7P
Mol. Mass.436.5198
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](O)COP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a