Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLethal(3)malignant brain tumor-like protein 4
LigandBDBM50440611
Substrate/Competitorn/a
Meas. Tech.ChEMBL_983407
IC50>10000±n/a nM
Citation James, LIKorboukh, VKKrichevsky, LBaughman, BMHerold, JMNorris, JLJin, JKireev, DBJanzen, WPArrowsmith, CHFrye, SV Small-molecule ligands of methyl-lysine binding proteins: optimization of selectivity for L3MBTL3. J Med Chem56:7358-71 (2013) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lethal(3)malignant brain tumor-like protein 4
Name:Lethal(3)malignant brain tumor-like protein 4
Synonyms:H-l(3)mbt-like protein 4 | L(3)mbt-like protein 4
Type:PROTEIN
Mol. Mass.:71132.81
Organism:Homo sapiens (Human)
Description:ChEMBL_983407
Residue:623
Sequence:
MKQPNRKRKLNMDSKERLDQDGRLEQAEEEKKPKDSTTPLSHVPSAAAQGAWSWEWYLKE
QKAVAAPVELFSKDQSFPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDG
YLSCYDFWTNAGSPDIHPVGWCEKTKHELHIPKGYRKDKFVWMDYLKACKLQNAPKKLFR
NRSPNGPMSKEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVN
SPYVQPVGWCQENGRTLIAPQGYPNPENFSWTEYLEATQTNAVPAKVFKMRLPHGFLPNM
KLEVVDKRNPRLIRVATIVDVDDQRVKVHFDGWDHKYDYWVEADSPDIHPIGWCDVTGHP
LEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDR
LREQTQANLESDSSHSKSKSLCSLNFNGKHEKVNSQPRLVQQAKCLKIKGKEDIDLDNLF
RVLVLHPRGLEYSVEQAQQVLHQSVSMSTVSAHPFRDLPLGREQHCKLLPGVADIRASQV
ARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNS
ILMFRHSQELPEEDIASGQEVRG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50440611
NameBDBM50440611
Synonyms:CHEMBL2426367
TypeSmall organic molecule
Emp. Form.C32H42N4O3
Mol. Mass.530.7009
SMILESO=C(N1CCC(CC1)N1CCCC1)c1ccc(C(=O)N2CCC(CC2)N2CCCC2)c(Oc2ccccc2)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a