Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTranslocator protein
LigandBDBM50131400
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1526857
Ki 806±n/a nM
Citation Narlawar, RWerry, ELScarf, AMHanani, RChua, SWKing, VABarron, MLMartins, RNIttner, LMRendina, LMKassiou, M First Demonstration of Positive Allosteric-like Modulation at the Human Wild Type Translocator Protein (TSPO). J Med Chem58:8743-9 (2015) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Translocator protein
Name:Translocator protein
Synonyms:Mitochondrial benzodiazepine receptor | PBR | PKBS | Peripheral benzodiazepine receptor-related protein | Peripheral-type benzodiazepine receptor
Type:Enzyme
Mol. Mass.:18834.74
Organism:Homo sapiens (Human)
Description:P30536
Residue:169
Sequence:
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAM
GYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAA
ATTVAWYQVSPLAARLLYPYLAWLAFTTTLNYCVWRDNHGWRGGRRLPE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131400
NameBDBM50131400
Synonyms:CHEMBL3634876
TypeSmall organic molecule
Emp. Form.C23H28N2O2
Mol. Mass.364.4806
SMILESCCN(CC)C(=O)Cn1c(cc2c(C)cc(C)cc12)-c1ccc(OC)cc1
Structure
n/a