BDBM50557745 CHEMBL4741913
SMILES CNc1nc2c(cnn2cc1C=C)-c1ccnc(OC)c1
InChI Key InChIKey=WSONRVSMVKMRMP-UHFFFAOYSA-N
Data 3 IC50
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 3 hits for monomerid = 50557745
Affinity DataIC50: <3nMAssay Description:Inhibition of TGFbeta receptor 2 (unknown origin) using biotin-labelled TTLKDLIYDMTTSGSGSGLPLLVQRTIARTsubstrate in presence of [gamma33P] ATP measure...More data for this Ligand-Target Pair
Affinity DataIC50: 1.40E+3nMAssay Description:Inhibition of ALK5 (unknown origin) using biotin-labelled KKKVLTQMGSPSIRCSpSVS substrate in presence of [gamma33P] ATP measured after 40 minMore data for this Ligand-Target Pair
Affinity DataIC50: 190nMAssay Description:Inhibition of ACVR2A (unknown origin) using biotin- labelled KTLQDLVYDLSTSGSGSGLPLFVQRTVART substrate in presence of [gamma33P] ATP measured after 20...More data for this Ligand-Target Pair