BDBM50570294 CHEMBL4855334
SMILES CNc1nc(C)c(s1)-c1nc(Nc2cccc(c2)N2CCN(C)CC2)ncc1Cl
InChI Key InChIKey=CSIAVORBNYKYNX-UHFFFAOYSA-N
Data 2 KI
Activity Spreadsheet -- Enzyme Inhibition Constant Data from BindingDB
Found 2 hits for monomerid = 50570294
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 5nMAssay Description:Inhibition of recombinant human full length CDK9/Cyclin T1 using [protein fragment, 39 aa] as substrate incubated for 40 mins in presen...More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nottingham
Curated by ChEMBL
University Of Nottingham
Curated by ChEMBL
Affinity DataKi: 107nMAssay Description:Inhibition of recombinant human full length CDK2/Cyclin A using histone H1 as substrate incubated for 40 mins in presence of [gamma-33P]-ATP by scint...More data for this Ligand-Target Pair