Found 3 Enz. Inhib. hit(s) with Target = 'Cyclin-A1/Cyclin-dependent kinase 2' and Ligand = 'BDBM2579'
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota
Curated by ChEMBL
University Of Minnesota
Curated by ChEMBL
Affinity DataIC50: 1.40nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measured after ...More data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota
Curated by ChEMBL
University Of Minnesota
Curated by ChEMBL
Affinity DataIC50: 1.5nMAssay Description:Inhibition of human CDK2/cyclin-A1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Minnesota
Curated by ChEMBL
University Of Minnesota
Curated by ChEMBL
Affinity DataIC50: 1.80nMAssay Description:Inhibition of human CDK2/cyclin-A1 using histone H1 as substrate by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair